LL-37 β Aliquot
$59.99
LL-37 Aliquot is a precision-prepared laboratory research peptide supplied in aliquot form for controlled antimicrobial and immunomodulatory research application and reproducible experimental handling. Available for fast, compliant shipping to all U.S. states and European countries.
-
Quality-assured with batch traceability and analytical documentation.
-
Concentration variance protection supports reproducible laboratory performance.
-
Precision aliquoting helps preserve integrity and simplify handling.
-
Secure, tamper-evident packaging helps protect product during transit.
Strictly for laboratory research purposes only. Not for human or veterinary use
LL-37 Aliquot β Research Grade
LL-37 Aliquot is a premium synthetic research peptide presented in aliquot form for precise laboratory handling and consistent experimental workflows. This cathelicidin peptide is commonly used in research focused on antimicrobial defense, immune modulation, and wound-response modeling, making it suitable for controlled in vitro/in vivo investigations.
Domestic orders ship directly from primary United States production facilities, while international orders are fulfilled through a dedicated United Kingdom shipping hub to support efficient customs clearance across the UK and continental Europe. This logistics structure helps ensure seamless delivery for investigators throughout all U.S. states and European countries.
-
Lot-coded batches with public third-party lab reports for transparency.
-
Strict manufacturing standards with minimal concentration variance.
-
Precision aliquot packaging engineered for accurate laboratory handling.
-
Secure transit packaging with tamper-proof seals.
Technical Specifications & Chemical Profile
| Chemical Property | Specification Data |
|---|---|
| Product Name | LL-37 |
| Form | Aliquot |
| Synonyms | Cathelicidin antimicrobial peptide LL-37; hCAP18 fragment |
| Sequence | [LL-37, 37 aa] |
| Molecular Formula | C205H340N60O53 |
| Molar Mass | 4492.3 g/mol |
| Chemical Class | Antimicrobial peptide |
| Research Focus | Antimicrobial activity, immune modulation, wound-response research |
| Appearance | Liquid aliquot |
| Storage | Store frozen or refrigerated per validated protocol |
| Solubility | Use validated aqueous or buffer-based solvent system appropriate for the assay |
Research Applications & Storage Protocols
Antimicrobial and Immune Modulation
LL-37 is used in laboratory research to study innate immune defense, antimicrobial membrane activity, and downstream immune signaling. It is relevant to experimental models examining host-defense peptides, cytokine-related pathways, and wound-response mechanisms under defined conditions.
Handling & Storage Guidelines
-
Long-Term Storage:Β Store at -20Β°C for extended stability.
-
Solubility:Β Use validated aqueous or buffer-based solvent systems appropriate for the assay.
-
Appearance:Β Liquid aliquot.
Global Logistics & Order Fulfillment
We proudly support scientific advancement across all 50 U.S. states and throughout Europe. Customers can seamlessly toggle their preferred currency betweenΒ USDΒ andΒ EURΒ using the currency switcher located on the left-hand side of our website. All shipments are securely packaged to withstand international transit without compromising structural or chemical stability.
Laboratory Use Only Disclaimer
This material is sold strictly for laboratory research and development use only. It is not approved for human consumption, nor for medical, veterinary, or household applications. All purchases are governed by our standard Terms & Conditions. Please review them carefully before placing your order.
| pa_feature |
Discountinued |
|---|---|
| pa_form |
Aliquots |
| pa_types |
Peptides |
You must be logged in to post a review.


Reviews
There are no reviews yet.