LL-37 – Aliquot

$59.99

LL-37 Aliquot is a precision-prepared laboratory research peptide supplied in aliquot form for controlled antimicrobial and immunomodulatory research application and reproducible experimental handling. Available for fast, compliant shipping to all U.S. states and European countries.

  • Quality-assured with batch traceability and analytical documentation.

  • Concentration variance protection supports reproducible laboratory performance.

  • Precision aliquoting helps preserve integrity and simplify handling.

  • Secure, tamper-evident packaging helps protect product during transit.

    Strictly for laboratory research purposes only. Not for human or veterinary use

Category:
Description

LL-37 Aliquot – Research Grade

LL-37 Aliquot is a premium synthetic research peptide presented in aliquot form for precise laboratory handling and consistent experimental workflows. This cathelicidin peptide is commonly used in research focused on antimicrobial defense, immune modulation, and wound-response modeling, making it suitable for controlled in vitro/in vivo investigations.

Domestic orders ship directly from primary United States production facilities, while international orders are fulfilled through a dedicated United Kingdom shipping hub to support efficient customs clearance across the UK and continental Europe. This logistics structure helps ensure seamless delivery for investigators throughout all U.S. states and European countries.

  • Lot-coded batches with public third-party lab reports for transparency.

  • Strict manufacturing standards with minimal concentration variance.

  • Precision aliquot packaging engineered for accurate laboratory handling.

  • Secure transit packaging with tamper-proof seals.

Technical Specifications & Chemical Profile

Chemical Property Specification Data
Product Name LL-37
Form Aliquot
Synonyms Cathelicidin antimicrobial peptide LL-37; hCAP18 fragment
Sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Molecular Formula C205H340N60O53
Molar Mass 4492.3 g/mol
Chemical Class Antimicrobial peptide
Research Focus Antimicrobial activity, immune modulation, wound-response research
Appearance Liquid aliquot
Storage Store frozen or refrigerated per validated protocol
Solubility Use validated aqueous or buffer-based solvent system appropriate for the assay

Research Applications & Storage Protocols

Antimicrobial and Immune Modulation

LL-37 is used in laboratory research to study innate immune defense, antimicrobial membrane activity, and downstream immune signaling. It is relevant to experimental models examining host-defense peptides, cytokine-related pathways, and wound-response mechanisms under defined conditions.

Handling & Storage Guidelines

  • Long-Term Storage:Β Store at -20Β°C for extended stability.

  • Solubility:Β Use validated aqueous or buffer-based solvent systems appropriate for the assay.

  • Appearance:Β Liquid aliquot.

Global Logistics & Order Fulfillment

We proudly support scientific advancement across all 50 U.S. states and throughout Europe. Customers can seamlessly toggle their preferred currency betweenΒ USDΒ andΒ EURΒ using the currency switcher located on the left-hand side of our website. All shipments are securely packaged to withstand international transit without compromising structural or chemical stability.

Laboratory Use Only Disclaimer

This material is sold strictly for laboratory research and development use only. It is not approved for human consumption, nor for medical, veterinary, or household applications. All purchases are governed by our standard Terms & Conditions. Please review them carefully before placing your order.

Additional information
pa_feature

Discountinued

pa_form

Aliquots

pa_types

Peptides

Reviews (0)

Reviews

There are no reviews yet.

Be the first to review “LL-37 – Aliquot”